Recombinant Full Length Human CALB2 Protein, GST-tagged

Cat.No. : CALB2-3046HF
Product Overview : Human CALB2 full-length ORF (NP_009018.1, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 179 amino acids
Description : This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This protein plays a role in diverse cellular functions, including message targeting and intracellular calcium buffering. It also functions as a modulator of neuronal excitability, and is a diagnostic marker for some human diseases, including Hirschsprung disease and some cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2010]
Molecular Mass : 47.1 kDa
AA Sequence : MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CALB2 calbindin 2 [ Homo sapiens ]
Official Symbol CALB2
Synonyms CALB2; calbindin 2; calbindin 2, 29kDa (calretinin); calretinin; CAL2; calbindin D29K; 29 kDa calbindin; calbindin 2, (29kD, calretinin); CR; CAB29;
Gene ID 794
mRNA Refseq NM_001740
Protein Refseq NP_001731
MIM 114051
UniProt ID P22676

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CALB2 Products

Required fields are marked with *

My Review for All CALB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon