Recombinant Human CADM1 Protein, GST-Tagged

Description :	CADM1 (Cell Adhesion Molecule 1) is a Protein Coding gene. Diseases associated with CADM1 include Retroperitoneal Fibrosis and Lung Cancer. Among its related pathways are Natural Killer Cell Receptors: Human Target Cell – NK Cell Ligand-Receptor Interactions and Cell junction organization. GO annotations related to this gene include protein homodimerization activity and PDZ domain binding. An important paralog of this gene is CADM2.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	36.74 kDa
AA Sequence :	IQRDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMT
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	CADM1 cell adhesion molecule 1 [ Homo sapiens ]
Official Symbol	CADM1
Synonyms	CADM1; cell adhesion molecule 1; IGSF4, immunoglobulin superfamily, member 4, TSLC1, tumor suppressor in lung cancer 1; BL2; IGSF4A; Necl 2; NECL2; nectin like 2; RA175; ST17; SYNCAM; SYNCAM1; TSLC-1; nectin-like 2; nectin-like protein 2; truncated CADM1 protein; TSLC1/Nectin-like 2/IGSF4; synaptic cell adhesion molecule; tumor suppressor in lung cancer 1; immunoglobulin superfamily member 4; immunoglobulin superfamily, member 4; spermatogenic immunoglobulin superfamily; immunoglobulin superfamily, member 4D variant 2; IGSF4; TSLC1; Necl-2; sgIGSF; sTSLC-1; synCAM1; MGC51880; MGC149785; DKFZp686F1789;
Gene ID	23705
mRNA Refseq	NM_001098517
Protein Refseq	NP_001091987
MIM	605686
UniProt ID	Q9BY67

ACE2-735H	Recombinant Human ACE2 Protein, His-tagged	+Inquiry
FGF10-15H	Active Recombinant Human FGF10 protein	+Inquiry
KITLG-19H	Active Recombinant Human KITLG Protein, Pre-aliquoted	+Inquiry
DEFB1-17H	Active Recombinant Human DEFB1 protein(1-47aa)	+Inquiry
DEFB4-18H	Active Recombinant Human DEFB4 protein(1-50aa)	+Inquiry