Active Recombinant Human CADM1, Fc-tagged

• Cat.No.: CADM1-647H
• Product Overview: The recombinant human NECL2-Fc fusion protein is expressed as a 531-amino acid protein consisting of Gln451 - His346 region of NECL2 (UniProt accession #Q9BY67 - isoform 5) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Species: Human
• Source: Human Cells
• Tag: Fc
• Protein Length: 451-346 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
• Bio-activity: Immobilized NECL2 binds CRTAM/CD355 in a functional ELISA
• Molecular Mass: Calculated molecular mass (kDa): 59.8; Estimated by SDS-PAGE under reducing condition (kDa): 70-80
• AA Sequence: QNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISD EGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEV EEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELT CEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDSRAGEEGS IRAVDHGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: CADM1 cell adhesion molecule 1 [ Homo sapiens ]
• Official Symbol: CADM1
• Synonyms: CADM1; cell adhesion molecule 1; IGSF4, immunoglobulin superfamily, member 4 , TSLC1, tumor suppressor in lung cancer 1; BL2; IGSF4A; Necl 2; NECL2; nectin like 2; RA175; ST17; SYNCAM; SYNCAM1; TSLC-1; nectin-like 2; nectin-like protein 2; truncated CADM1 protein; TSLC1/Nectin-like 2/IGSF4; synaptic cell adhesion molecule; tumor suppressor in lung cancer 1; immunoglobulin superfamily member 4; immunoglobulin superfamily, member 4; spermatogenic immunoglobulin superfamily; immunoglobulin superfamily, member 4D variant 2; IGSF4; TSLC1; Necl-2; sgIGSF; sTSLC-1; synCAM1; MGC51880; MGC149785; DKFZp686F1789
• Gene ID: 23705
• mRNA Refseq: NM_001098517
• Protein Refseq: NP_001091987
• MIM: 605686
• UniProt ID: Q9BY67
• Chromosome Location: 11q23.2
• Pathway: Adherens junctions interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; Nectin/Necltrans heterodimerization, organism-specific biosystem
• Function: PDZ domain binding; protein C-terminus binding; protein homodimerization activity; receptor binding; receptor binding