Recombinant Human CACNA2D1 protein, GST-tagged

• Cat.No.: CACNA2D1-3729H
• Product Overview: Recombinant Human CACNA2D1 protein(25-124 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 25-124 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MEPFPSAVTIKSWVDKMQEDLVTLAKTASGVNQLVDIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASNEVVY
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CACNA2D1 calcium channel, voltage-dependent, alpha 2/delta subunit 1 [ Homo sapiens ]
• Official Symbol: CACNA2D1
• Synonyms: CACNA2D1; calcium channel, voltage-dependent, alpha 2/delta subunit 1; CACNA2, CACNL2A, MHS3; voltage-dependent calcium channel subunit alpha-2/delta-1; calcium channel, L type, alpha 2 polypeptide; voltage-gated calcium channel subunit alpha-2/delta-1; dihydropyridine-sensitive L-type, calcium channel alpha-2/delta subunit; CACNA2; CCHL2A; CACNL2A
• Gene ID: 781
• mRNA Refseq: NM_000722
• Protein Refseq: NP_000713
• MIM: 114204
• UniProt ID: P54289