Recombinant Human CACNA1E Protein, GST-Tagged

• Cat.No.: CACNA1E-0265H
• Product Overview: Human CACNA1E partial ORF (NP_000712, 1901 a.a. - 1999 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Voltage-dependent calcium channels are multisubunit complexes consisting of alpha-1, alpha-2, beta, and delta subunits in a 1:1:1:1 ratio. These channels mediate the entry of calcium ions into excitable cells, and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. This gene encodes the alpha-1E subunit of the R-type calcium channels, which belong to the 'high-voltage activated' group that maybe involved in the modulation of firing patterns of neurons important for information processing. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Apr 2011]
• Molecular Mass: 36.63 kDa
• AA Sequence: RMEPSSLPQEIIANAKALPYLQQDPVSGLSGRSGYPSMSPLSPQDIFQLACMDPADDGQFQERQSLVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CACNA1E calcium channel, voltage-dependent, R type, alpha 1E subunit [ Homo sapiens ]
• Official Symbol: CACNA1E
• Synonyms: CACNA1E; calcium channel, voltage-dependent, R type, alpha 1E subunit; CACNL1A6; voltage-dependent R-type calcium channel subunit alpha-1E; BII; CACH6; Cav2.3; brain calcium channel II; voltage-gated calcium channel alpha 1E subunit; voltage-dependent calcium channel alpha 1E subunit; voltage-gated calcium channel alpha subunit Cav2.3; voltage-gated calcium channel subunit alpha Cav2.3; calcium channel, voltage-dependent, alpha 1E subunit; calcium channel, L type, alpha-1 polypeptide, isoform 6; calcium channel, R type, alpha-1 polypeptide, isoform 6
• Gene ID: 777
• mRNA Refseq: NM_000721
• Protein Refseq: NP_000712
• MIM: 601013
• UniProt ID: Q15878