Recombinant Human CACNA1C protein, His-tagged
| Cat.No. : | CACNA1C-117H |
| Product Overview : | Recombinant Human CACNA1C protein(Q13936)(Glu431-Asn510), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | Human |
| Tag : | C-His |
| Protein length : | Glu431-Asn510 |
| Form : | Phosphate buffered saline. |
| Molecular Mass : | 12 kDa |
| AASequence : | EEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN |
| Storage : | Store at -20°C to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | CACNA1C calcium channel, voltage-dependent, L type, alpha 1C subunit [ Homo sapiens ] |
| Official Symbol | CACNA1C |
| Synonyms | CACNA1C; calcium channel, voltage-dependent, L type, alpha 1C subunit; CACNL1A1, CCHL1A1; voltage-dependent L-type calcium channel subunit alpha-1C; CACH2; CACN2; Cav1.2; TS; DHPR, alpha-1 subunit; calcium channel, cardic dihydropyridine-sensitive, alpha-1 subunit; calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle; voltage-gated L-type calcium channel Cav1.2 alpha 1 subunit, splice variant 10*; CaV1.2; CCHL1A1; CACNL1A1; MGC120730; |
| Gene ID | 775 |
| mRNA Refseq | NM_000719 |
| Protein Refseq | NP_000710 |
| MIM | 114205 |
| UniProt ID | Q13936 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CACNA1C Products
Required fields are marked with *
My Review for All CACNA1C Products
Required fields are marked with *
0
Inquiry Basket
