Recombinant Human CABIN1 Protein, GST-Tagged

• Cat.No.: CABIN1-0255H
• Product Overview: Human CABIN1 partial ORF (NP_036427, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Calcineurin plays an important role in the T-cell receptor-mediated signal transduction pathway. The protein encoded by this gene binds specifically to the activated form of calcineurin and inhibits calcineurin-mediated signal transduction. The encoded protein is found in the nucleus and contains a leucine zipper domain as well as several PEST motifs, sequences which confer targeted degradation to those proteins which contain them. Alternative splicing results in multiple transcript variants encoding two different isoforms. [provided by RefSeq, Jan 2011]
• Molecular Mass: 37.84 kDa
• AA Sequence: MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYHELLEASLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CABIN1 calcineurin binding protein 1 [ Homo sapiens ]
• Official Symbol: CABIN1
• Synonyms: CABIN1; calcineurin binding protein 1; calcineurin-binding protein cabin-1; KIAA0330; PPP3IN; calcineurin inhibitor; calcineurin binding protein cabin 1; CAIN
• Gene ID: 23523
• mRNA Refseq: NM_001199281
• Protein Refseq: NP_001186210
• MIM: 604251
• UniProt ID: Q9Y6J0