Recombinant Human CA14 Protein, His-tagged
Cat.No. : | CA14-118H |
Product Overview : | Recombinant human CA14 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 337 |
Description : | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA XIV is predicted to be a type I membrane protein and shares highest sequence similarity with the other transmembrane CA isoform, CA XII; however, they have different patterns of tissue-specific expression and thus may play different physiologic roles. |
Form : | Lyophilized |
Molecular Mass : | 31.6 kDa |
AA Sequence : | MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CA14 carbonic anhydrase XIV [ Homo sapiens (human) ] |
Official Symbol | CA14 |
Synonyms | CA14; carbonic anhydrase XIV; carbonic anhydrase 14; CA-XIV; carbonic dehydratase; carbonate dehydratase XIV; CAXiV; |
Gene ID | 23632 |
mRNA Refseq | NM_012113 |
Protein Refseq | NP_036245 |
MIM | 604832 |
UniProt ID | Q9ULX7 |
◆ Recombinant Proteins | ||
CAR14-2716M | Recombinant Mouse CAR14 Protein | +Inquiry |
CA14-0138H | Recombinant Human CA14 Protein (Gly19-Met290), N-His-tagged | +Inquiry |
CA14-10617H | Recombinant Human CA14, GST-tagged | +Inquiry |
CA14-3586Z | Recombinant Zebrafish CA14 | +Inquiry |
CA14-269H | Recombinant Human CA14 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA14-2802HCL | Recombinant Human CA14 cell lysate | +Inquiry |
CA14-3064MCL | Recombinant Mouse CA14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CA14 Products
Required fields are marked with *
My Review for All CA14 Products
Required fields are marked with *
0
Inquiry Basket