Recombinant Human CA14 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: CA14-269H
• Product Overview: CA14 MS Standard C13 and N15-labeled recombinant protein (NP_036245) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA XIV is predicted to be a type I membrane protein and shares highest sequence similarity with the other transmembrane CA isoform, CA XII; however, they have different patterns of tissue-specific expression and thus may play different physiologic roles. [provided by RefSeq, Jul 2008]
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 37.7 kDa
• AA Sequence: MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CA14 carbonic anhydrase XIV [ Homo sapiens (human) ]
• Official Symbol: CA14
• Synonyms: CA14; carbonic anhydrase XIV; carbonic anhydrase 14; CA-XIV; carbonic dehydratase; carbonate dehydratase XIV; CAXiV
• Gene ID: 23632
• mRNA Refseq: NM_012113
• Protein Refseq: NP_036245
• MIM: 604832
• UniProt ID: Q9ULX7