Recombinant Human CA10 Protein, GST-Tagged

• Cat.No.: CA10-0229H
• Product Overview: Human CA10 partial ORF (NP_064563.1, 229 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein that belongs to the carbonic anhydrase family of zinc metalloenzymes, which catalyze the reversible hydration of carbon dioxide in various biological processes. The protein encoded by this gene is an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: TSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CA10 carbonic anhydrase X [ Homo sapiens ]
• Official Symbol: CA10
• Synonyms: CA10; carbonic anhydrase X; carbonic anhydrase-related protein 10; CA RPX; CARPX; HUCEP 15; CARP X; CA-RP X; cerebral protein 15; cerebral protein-15; carbonic anhydrase-related protein X; CA-RPX; HUCEP-15
• Gene ID: 56934
• mRNA Refseq: NM_001082533
• Protein Refseq: NP_001076002
• MIM: 604642
• UniProt ID: Q9NS85