Active Recombinant Human CA10 Protein (22-328aa), C-His-tagged

• Cat.No.: CA10-16H
• Product Overview: Recombinant human Carbonic Anhydrase X/CA10 (22-328aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Description: Carbonic anhydrase X, also known as CA10, belongs to the CA family of zinc metalloenzymes. It is catalyze the reversible hydration of carbon dioxide in various biological processes such as respiration, renal tubular acidification and bone resorption. Also an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development.
• Source: HEK293
• Species: Human
• Tag: His
• Form: Liquid
• Bio-activity: Specific activity is > 150 pmol/min/μg, and is defined as the amount of enzyme that hydrolyze 1pmole of p-nitrophenyl acetate to p-nitrophenol per minute at pH 8.0 at 37 centigrade.
• Molecular Mass: 36.3 kDa (317 aa)
• Protein length: 22-328 aa
• AA Sequence: QQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Enzyme Activity
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by Absorbance at 280 nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: CA10 carbonic anhydrase X [ Homo sapiens (human) ]
• Official Symbol: CA10
• Synonyms: CA10; carbonic anhydrase X; carbonic anhydrase-related protein 10; CA RPX; CARPX; HUCEP 15; CARP X; CA-RP X; cerebral protein 15; cerebral protein-15; carbonic anhydrase-related protein X; CA-RPX; HUCEP-15
• Gene ID: 56934
• mRNA Refseq: NM_020178
• Protein Refseq: NP_064563
• MIM: 604642
• UniProt ID: Q9NS85