Recombinant Human C9orf85 Protein, GST-Tagged
Cat.No. : | C9orf85-0216H |
Product Overview : | Human C9orf85 full-length ORF (NP_872311.2, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | C9orf85 (Chromosome 9 Open Reading Frame 85) is a Protein Coding gene. |
Molecular Mass : | 44.7 kDa |
AA Sequence : | MSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYHIMCRPCACELEVCAKCGKKEDIVIPLNKETEKIEHTENNLSSNHRRSCRRNEESDDDLDFDIDLEDTGGDHQMN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C9orf85 chromosome 9 open reading frame 85 [ Homo sapiens (human) ] |
Official Symbol | C9orf85 |
Synonyms | C9orf85; chromosome 9 open reading frame 85; uncharacterized protein C9orf85; Chromosome 9 Open Reading Frame 85 |
Gene ID | 138241 |
mRNA Refseq | NM_182505 |
Protein Refseq | NP_872311 |
UniProt ID | Q96MD7 |
◆ Recombinant Proteins | ||
C9orf85-743H | Recombinant Human C9orf85 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C9orf85-2726HF | Recombinant Full Length Human C9orf85 Protein, GST-tagged | +Inquiry |
C9orf85-0216H | Recombinant Human C9orf85 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C9orf85-7923HCL | Recombinant Human C9orf85 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C9orf85 Products
Required fields are marked with *
My Review for All C9orf85 Products
Required fields are marked with *
0
Inquiry Basket