Recombinant Full Length Human C9orf85 Protein, GST-tagged

• Cat.No.: C9orf85-2726HF
• Product Overview: Human C9orf85 full-length ORF (NP_872311.2, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C9orf85 (Chromosome 9 Open Reading Frame 85) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 44.7 kDa
• Protein length: 157 amino acids
• AA Sequence: MSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYHIMCRPCACELEVCAKCGKKEDIVIPLNKETEKIEHTENNLSSNHRRSCRRNEESDDDLDFDIDLEDTGGDHQMN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C9orf85 chromosome 9 open reading frame 85 [ Homo sapiens (human) ]
• Official Symbol: C9orf85
• Synonyms: C9orf85; chromosome 9 open reading frame 85; uncharacterized protein C9orf85; Chromosome 9 Open Reading Frame 85
• Gene ID: 138241
• mRNA Refseq: NM_182505
• Protein Refseq: NP_872311
• UniProt ID: Q96MD7