Recombinant Human C9orf66 Protein, GST-Tagged

• Cat.No.: C9orf66-0209H
• Product Overview: Human C9orf66 full-length ORF (BAB70995.1, 1 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C9orf66 (Chromosome 9 Open Reading Frame 66) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 57.5 kDa
• AA Sequence: MRHSVARPTRLPRRLSPFWDPATCKNLEGGAGEVVRGRDPRRLRTSRSTEILGEGLAGPSAGAAARPAAPPPQPREPGAPGLRRAPPRTRMDSSGLGPCSEAPLHTSAGLSGRNLRAAGGVLPVDLERERAALCARQSGHGPPAVRWLLGSRGAESGGLARRRVAAEHAQPSANLVCRSALETSAFPPSKPKSPRGRVRARSSDGRLRHPAWRAGSGGRGGRGPSAELASRYWGRRRALPGAADLRPKGARADDRRPLRAGRKLHLPEAARLPGNVGKSGEPHKAGEVGNHPRDS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C9orf66 chromosome 9 open reading frame 66 [ Homo sapiens ]
• Official Symbol: C9orf66
• Synonyms: RP11-59O6.1
• Gene ID: 157983
• mRNA Refseq: NM_152569
• Protein Refseq: NP_689782
• UniProt ID: Q5T8R8