Recombinant Full Length Human C9orf66 Protein, GST-tagged

Cat.No. : C9orf66-2721HF
Product Overview : Human C9orf66 full-length ORF (BAB70995.1, 1 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 295 amino acids
Description : C9orf66 (Chromosome 9 Open Reading Frame 66) is a Protein Coding gene.
Molecular Mass : 57.5 kDa
AA Sequence : MRHSVARPTRLPRRLSPFWDPATCKNLEGGAGEVVRGRDPRRLRTSRSTEILGEGLAGPSAGAAARPAAPPPQPREPGAPGLRRAPPRTRMDSSGLGPCSEAPLHTSAGLSGRNLRAAGGVLPVDLERERAALCARQSGHGPPAVRWLLGSRGAESGGLARRRVAAEHAQPSANLVCRSALETSAFPPSKPKSPRGRVRARSSDGRLRHPAWRAGSGGRGGRGPSAELASRYWGRRRALPGAADLRPKGARADDRRPLRAGRKLHLPEAARLPGNVGKSGEPHKAGEVGNHPRDS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C9orf66 chromosome 9 open reading frame 66 [ Homo sapiens ]
Official Symbol C9orf66
Synonyms RP11-59O6.1
Gene ID 157983
mRNA Refseq NM_152569
Protein Refseq NP_689782
UniProt ID Q5T8R8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C9orf66 Products

Required fields are marked with *

My Review for All C9orf66 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon