Recombinant Human C9ORF163 Protein (1-203 aa), His-SUMO-tagged

• Cat.No.: C9ORF163-1070H
• Product Overview: Recombinant Human C9ORF163 Protein (1-203 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 38.2 kDa
• Protein length: 1-203 aa
• AA Sequence: MPGPLTCTPAWQGQGRAAAFLCCSFQRAGAVVGVPARWHRGRLSSQQRLRSSLGGSHPCPQLGRRLVREGVISVPRQQGRRRCRESFSPADVAPGPICSANICLSGVRFLTCLNRVREHVVGPSPSPAAPICFFPVVEALCTLRGRRCHCLPFPKRGMQRWMLPLRRGARLLPLASSKNPRARSPGLDPLGSSETLWSHRGGH
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: C9orf163 chromosome 9 open reading frame 163 [ Homo sapiens ]
• Official Symbol: C9ORF163
• Synonyms: RP11-413M3.11
• Gene ID: 158055
• mRNA Refseq: NM_152571.2
• Protein Refseq: NP_689784.1
• UniProt ID: Q8N9P6