Recombinant Human C9ORF163 Protein (1-203 aa), His-SUMO-tagged

Cat.No. : C9ORF163-1070H
Product Overview : Recombinant Human C9ORF163 Protein (1-203 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-203 aa
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 38.2 kDa
AA Sequence : MPGPLTCTPAWQGQGRAAAFLCCSFQRAGAVVGVPARWHRGRLSSQQRLRSSLGGSHPCPQLGRRLVREGVISVPRQQGRRRCRESFSPADVAPGPICSANICLSGVRFLTCLNRVREHVVGPSPSPAAPICFFPVVEALCTLRGRRCHCLPFPKRGMQRWMLPLRRGARLLPLASSKNPRARSPGLDPLGSSETLWSHRGGH
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name C9orf163 chromosome 9 open reading frame 163 [ Homo sapiens ]
Official Symbol C9ORF163
Synonyms RP11-413M3.11;
Gene ID 158055
mRNA Refseq NM_152571.2
Protein Refseq NP_689784.1
UniProt ID Q8N9P6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C9ORF163 Products

Required fields are marked with *

My Review for All C9ORF163 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon