Recombinant Full Length Human C9orf163 Protein, GST-tagged

Cat.No. : C9orf163-2693HF
Product Overview : Human C9orf163 full-length ORF (NP_689784.1, 1 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : C9orf163 (Chromosome 9 Open Reading Frame 163) is a Protein Coding gene.
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 48.6 kDa
Protein length : 203 amino acids
AA Sequence : MPGPLTCTPAWQGQGRAAAFLCCSFQRAGAVVGVPARWHRGRLSSQQRLRSSLGGSHPCPQLGRRLVREGVISVPRQQGRRRCRESFSPADVAPGPICSANICLSGVRFLTCLNRVREHVVGPSPSPAAPICFFPVVEALCTLRGRRCHCLPFPKRGMQRWMLPLRRGARLLPLASSKNPRARSPGLDPLGSSETLWSHRGGH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C9orf163 chromosome 9 open reading frame 163 [ Homo sapiens ]
Official Symbol C9orf163
Synonyms RP11-413M3.11
Gene ID 158055
mRNA Refseq NM_152571
Protein Refseq NP_689784
UniProt ID Q96NJ1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C9orf163 Products

Required fields are marked with *

My Review for All C9orf163 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon