Recombinant Human C8G Protein, His-Tagged

• Cat.No.: C8G-0156H
• Product Overview: Human C8G (AAI13625, 21 a.a. - 202 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.

Specification

• Description: The protein encoded by this gene belongs to the lipocalin family. It is one of the three subunits that constitutes complement component 8 (C8), which is composed of a disulfide-linked C8 alpha-gamma heterodimer and a non-covalently associated C8 beta chain. C8 participates in the formation of the membrane attack complex (MAC) on bacterial cell membranes. While subunits alpha and beta play a role in complement-mediated bacterial killing, the gamma subunit is not required for the bactericidal activity. [provided by RefSeq, Jul 2011]
• Source: E. coli
• Species: Human
• Tag: His
• Form: Liquid
• Molecular Mass: 22.6 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
• Purity: > 95% by SDS-PAGE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL
• Storage Buffer: In 20 mM Tris-HCl, 0.15 M NaCl, pH 8.0. (10% glycerol, 2 mM DTT)
• Protein length: 21-202 a.a.

Gene Information

• Gene Name: C8G complement component 8, gamma polypeptide [ Homo sapiens ]
• Official Symbol: C8G
• Synonyms: C8G; complement component 8, gamma polypeptide; complement component C8 gamma chain; C8C; MGC142186
• Gene ID: 733
• mRNA Refseq: NM_000606
• Protein Refseq: NP_000597
• MIM: 120930
• UniProt ID: P07360