Recombinant Human C8G Protein, His-Tagged
Cat.No. : | C8G-0156H |
Product Overview : | Human C8G (AAI13625, 21 a.a. - 202 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-202 a.a. |
Description : | The protein encoded by this gene belongs to the lipocalin family. It is one of the three subunits that constitutes complement component 8 (C8), which is composed of a disulfide-linked C8 alpha-gamma heterodimer and a non-covalently associated C8 beta chain. C8 participates in the formation of the membrane attack complex (MAC) on bacterial cell membranes. While subunits alpha and beta play a role in complement-mediated bacterial killing, the gamma subunit is not required for the bactericidal activity. [provided by RefSeq, Jul 2011] |
Form : | Liquid |
Molecular Mass : | 22.6 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR |
Purity : | > 95% by SDS-PAGE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL |
Storage Buffer : | In 20 mM Tris-HCl, 0.15 M NaCl, pH 8.0. (10% glycerol, 2 mM DTT) |
Gene Name | C8G complement component 8, gamma polypeptide [ Homo sapiens ] |
Official Symbol | C8G |
Synonyms | C8G; complement component 8, gamma polypeptide; complement component C8 gamma chain; C8C; MGC142186; |
Gene ID | 733 |
mRNA Refseq | NM_000606 |
Protein Refseq | NP_000597 |
MIM | 120930 |
UniProt ID | P07360 |
◆ Recombinant Proteins | ||
C8G-0156H | Recombinant Human C8G Protein, His-Tagged | +Inquiry |
C8G-0583H | Recombinant Human C8G Protein (Lys39-Arg202), N-GST-tagged | +Inquiry |
C8G-2788H | Recombinant Human C8G Protein, His-tagged | +Inquiry |
C8G-4234H | Recombinant Human C8G protein, His-tagged | +Inquiry |
C8G-11112Z | Recombinant Zebrafish C8G | +Inquiry |
◆ Cell & Tissue Lysates | ||
C8G-130HCL | Recombinant Human C8G lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C8G Products
Required fields are marked with *
My Review for All C8G Products
Required fields are marked with *
0
Inquiry Basket