Recombinant Human C6orf163 Protein, GST-Tagged

• Cat.No.: C6orf163-0110H
• Product Overview: Human C6orf163 full-length ORF (1 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C6orf163 (Chromosome 6 Open Reading Frame 163) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 50.1 kDa
• AA Sequence: MYQNMDDEMKREHLAAELRMVHRIQRIMMECHREKVEAVEKARAEERHIAQEAIQAQKSKAVEEIVNTGVTVIKDEKTSVARLMREKEHEMSILYGIAQRQRQEEVQEVLQEAEKTHQATLGNMMDKLANTQGELLSIAKQLGIMTNWKDFLEEELQETRMAFQKYINYTFPKLSPGHADFILPERKKTPSNLVIKENKTTLD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C6orf163 chromosome 6 open reading frame 163 [ Homo sapiens ]
• Official Symbol: C6orf163
• Synonyms: C6orf163; chromosome 6 open reading frame 163; Chromosome 6 Open Reading Frame 163
• Gene ID: 206412
• mRNA Refseq: NM_001010868
• Protein Refseq: NP_001010868
• UniProt ID: Q5TEZ5