Recombinant Human C6orf163 Protein, GST-Tagged

Cat.No. : C6orf163-0110H
Product Overview : Human C6orf163 full-length ORF (1 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : C6orf163 (Chromosome 6 Open Reading Frame 163) is a Protein Coding gene.
Molecular Mass : 50.1 kDa
AA Sequence : MYQNMDDEMKREHLAAELRMVHRIQRIMMECHREKVEAVEKARAEERHIAQEAIQAQKSKAVEEIVNTGVTVIKDEKTSVARLMREKEHEMSILYGIAQRQRQEEVQEVLQEAEKTHQATLGNMMDKLANTQGELLSIAKQLGIMTNWKDFLEEELQETRMAFQKYINYTFPKLSPGHADFILPERKKTPSNLVIKENKTTLD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C6orf163 chromosome 6 open reading frame 163 [ Homo sapiens ]
Official Symbol C6orf163
Synonyms C6orf163; chromosome 6 open reading frame 163; Chromosome 6 Open Reading Frame 163
Gene ID 206412
mRNA Refseq NM_001010868
Protein Refseq NP_001010868
UniProt ID Q5TEZ5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C6orf163 Products

Required fields are marked with *

My Review for All C6orf163 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon