Recombinant Full Length Human C6orf163 Protein, GST-tagged
Cat.No. : | C6orf163-2691HF |
Product Overview : | Human C6orf163 full-length ORF (1 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 203 amino acids |
Description : | C6orf163 (Chromosome 6 Open Reading Frame 163) is a Protein Coding gene. |
Molecular Mass : | 50.1 kDa |
AA Sequence : | MYQNMDDEMKREHLAAELRMVHRIQRIMMECHREKVEAVEKARAEERHIAQEAIQAQKSKAVEEIVNTGVTVIKDEKTSVARLMREKEHEMSILYGIAQRQRQEEVQEVLQEAEKTHQATLGNMMDKLANTQGELLSIAKQLGIMTNWKDFLEEELQETRMAFQKYINYTFPKLSPGHADFILPERKKTPSNLVIKENKTTLD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C6orf163 chromosome 6 open reading frame 163 [ Homo sapiens ] |
Official Symbol | C6orf163 |
Synonyms | C6orf163; chromosome 6 open reading frame 163; Chromosome 6 Open Reading Frame 163 |
Gene ID | 206412 |
mRNA Refseq | NM_001010868 |
Protein Refseq | NP_001010868 |
UniProt ID | Q5TEZ5 |
◆ Recombinant Proteins | ||
C6orf163-2691HF | Recombinant Full Length Human C6orf163 Protein, GST-tagged | +Inquiry |
C6orf163-5353H | Recombinant Human C6orf163 protein, His&Myc-tagged | +Inquiry |
C6orf163-0110H | Recombinant Human C6orf163 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C6orf163 Products
Required fields are marked with *
My Review for All C6orf163 Products
Required fields are marked with *
0
Inquiry Basket