Recombinant Human C5orf64 Protein, GST-tagged
| Cat.No. : | C5orf64-4324H |
| Product Overview : | Human FLJ37543 full-length ORF (BAC04439.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | C5orf64 (Chromosome 5 Open Reading Frame 64) is a Protein Coding gene. |
| Source : | Wheat Germ |
| Species : | Human |
| Tag : | GST |
| Molecular Mass : | 40.7 kDa |
| AA Sequence : | MLAPLFLCCLRNLFRKLISFQPPQLGRTNMHYSKLPRTAIETEFKQNVGPPPKDLTAEVYFPSIKSRSHLPAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKSTPIPILGVAM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C5orf64 chromosome 5 open reading frame 64 [ Homo sapiens (human) ] |
| Official Symbol | C5orf64 |
| Synonyms | C5orf64; chromosome 5 open reading frame 64; uncharacterized protein C5orf64 |
| Gene ID | 285668 |
| mRNA Refseq | NM_173667 |
| Protein Refseq | NP_775938 |
| UniProt ID | Q2M2E5 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C5orf64 Products
Required fields are marked with *
My Review for All C5orf64 Products
Required fields are marked with *
0
Inquiry Basket
