Recombinant Full Length Human C5orf64 Protein, GST-tagged

• Cat.No.: C5orf64-5052HF
• Product Overview: Human FLJ37543 full-length ORF (BAC04439.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C5orf64 (Chromosome 5 Open Reading Frame 64) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 40.7 kDa
• Protein length: 130 amino acids
• AA Sequence: MLAPLFLCCLRNLFRKLISFQPPQLGRTNMHYSKLPRTAIETEFKQNVGPPPKDLTAEVYFPSIKSRSHLPAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKSTPIPILGVAM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C5orf64 chromosome 5 open reading frame 64 [ Homo sapiens (human) ]
• Official Symbol: C5orf64
• Synonyms: C5orf64; chromosome 5 open reading frame 64; uncharacterized protein C5orf64
• Gene ID: 285668
• mRNA Refseq: NM_173667
• Protein Refseq: NP_775938
• UniProt ID: Q2M2E5