Recombinant Human C5orf30 Protein, GST-Tagged

• Cat.No.: C5orf30-0085H
• Product Overview: Human C5orf30 full-length ORF (NP_149988.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: C5orf30 (Chromosome 5 Open Reading Frame 30) is a Protein Coding gene. Diseases associated with C5orf30 include Rheumatoid Arthritis.
• Molecular Mass: 49.5 kDa
• AA Sequence: MEVDINGESRSTLTTLPFPGAEANSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGFTTGEELLKLAQKCTGGEESKAEAMPSLRSKQLDAGLARSSRLYKTRSRYYQPYEIPAVNGRRRRRMPSSGDKCTKSLPYEPYKALHGPLPLCLLKGKRAHSKSLDYLNLDKMIKEPADTEVLQYQLQHLTLRGDRVFARNNT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C5orf30 chromosome 5 open reading frame 30 [ Homo sapiens (human) ]
• Official Symbol: C5orf30
• Synonyms: C5orf30; chromosome 5 open reading frame 30; UNC119-binding protein C5orf30; UPF0684 protein C5orf30; Chromosome 5 Open Reading Frame 30; UNC119-Binding Protein
• Gene ID: 90355
• mRNA Refseq: NM_001316968
• Protein Refseq: NP_001303897
• MIM: 616608
• UniProt ID: Q96GV9