Recombinant Full Length Human C5orf30 Protein, GST-tagged

Cat.No. : C5orf30-2666HF
Product Overview : Human C5orf30 full-length ORF (NP_149988.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 206 amino acids
Description : C5orf30 (Chromosome 5 Open Reading Frame 30) is a Protein Coding gene. Diseases associated with C5orf30 include Rheumatoid Arthritis.
Molecular Mass : 49.5 kDa
AA Sequence : MEVDINGESRSTLTTLPFPGAEANSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGFTTGEELLKLAQKCTGGEESKAEAMPSLRSKQLDAGLARSSRLYKTRSRYYQPYEIPAVNGRRRRRMPSSGDKCTKSLPYEPYKALHGPLPLCLLKGKRAHSKSLDYLNLDKMIKEPADTEVLQYQLQHLTLRGDRVFARNNT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C5orf30 chromosome 5 open reading frame 30 [ Homo sapiens (human) ]
Official Symbol C5orf30
Synonyms C5orf30; chromosome 5 open reading frame 30; UNC119-binding protein C5orf30; UPF0684 protein C5orf30; Chromosome 5 Open Reading Frame 30; UNC119-Binding Protein
Gene ID 90355
mRNA Refseq NM_001316968
Protein Refseq NP_001303897
MIM 616608
UniProt ID Q96GV9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C5orf30 Products

Required fields are marked with *

My Review for All C5orf30 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon