Recombinant Human C5orf24 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | C5orf24-574H |
Product Overview : | C5orf24 MS Standard C13 and N15-labeled recombinant protein (NP_001129058) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | C5orf24 (Chromosome 5 Open Reading Frame 24) is a Protein Coding gene. |
Molecular Mass : | 20.1 kDa |
AA Sequence : | MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGRSIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGRPPGSIKALSRLADLGYGCGTAAFPYPMMHGRAVHGVEETSSEVKPPNETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C5orf24 chromosome 5 open reading frame 24 [ Homo sapiens (human) ] |
Official Symbol | C5orf24 |
Synonyms | C5ORF24; chromosome 5 open reading frame 24; UPF0461 protein C5orf24; FLJ37562; |
Gene ID | 134553 |
mRNA Refseq | NM_001135586 |
Protein Refseq | NP_001129058 |
UniProt ID | Q7Z6I8 |
◆ Recombinant Proteins | ||
C5orf24-5348H | Recombinant Human C5orf24 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C5orf24-574H | Recombinant Human C5orf24 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C5orf24-0084H | Recombinant Human C5orf24 Protein, GST-Tagged | +Inquiry |
C5orf24-2664HF | Recombinant Full Length Human C5orf24 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C5orf24-8017HCL | Recombinant Human C5orf24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C5orf24 Products
Required fields are marked with *
My Review for All C5orf24 Products
Required fields are marked with *
0
Inquiry Basket