Recombinant Full Length Human C5orf24 Protein, GST-tagged

• Cat.No.: C5orf24-2664HF
• Product Overview: Human C5orf24 full-length ORF (NP_689622.2, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C5orf24 (Chromosome 5 Open Reading Frame 24) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 46.5 kDa
• Protein length: 188 amino acids
• AA Sequence: MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGRSIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGRPPGSIKALSRLADLGYGCGTAAFPYPMMHGRAVHGVEETSSEVKPPNE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C5orf24 chromosome 5 open reading frame 24 [ Homo sapiens ]
• Official Symbol: C5orf24
• Synonyms: C5ORF24; chromosome 5 open reading frame 24; UPF0461 protein C5orf24; FLJ37562
• Gene ID: 134553
• mRNA Refseq: NM_001135586
• Protein Refseq: NP_001129058
• UniProt ID: Q7Z6I8