Recombinant Full Length Human C5orf24 Protein, GST-tagged

Cat.No. : C5orf24-2664HF
Product Overview : Human C5orf24 full-length ORF (NP_689622.2, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 188 amino acids
Description : C5orf24 (Chromosome 5 Open Reading Frame 24) is a Protein Coding gene.
Molecular Mass : 46.5 kDa
AA Sequence : MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGRSIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGRPPGSIKALSRLADLGYGCGTAAFPYPMMHGRAVHGVEETSSEVKPPNE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C5orf24 chromosome 5 open reading frame 24 [ Homo sapiens ]
Official Symbol C5orf24
Synonyms C5ORF24; chromosome 5 open reading frame 24; UPF0461 protein C5orf24; FLJ37562;
Gene ID 134553
mRNA Refseq NM_001135586
Protein Refseq NP_001129058
UniProt ID Q7Z6I8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C5orf24 Products

Required fields are marked with *

My Review for All C5orf24 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon