Recombinant Human C4B

Cat.No. : C4B-27789TH
Product Overview : Recombinant fragment corresponding to amino acids 1347-1446 of Human C4b with a proprietary tag; predicted MWt 36.63kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Varying haplotypes of this gene cluster exist, such that individuals may have 1, 2, or 3 copies of this gene. In addition, this gene exists as a long form and a short form due to the presence or absence of a 6.4 kb endogenous HERV-K retrovirus in intron 9.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEG
Sequence Similarities : Contains 1 anaphylatoxin-like domain.Contains 1 NTR domain.
Gene Name C4B complement component 4B (Chido blood group) [ Homo sapiens ]
Official Symbol C4B
Synonyms C4B; complement component 4B (Chido blood group); complement component 4B; complement C4-B; C4B1; C4B3; C4F; CH; CO4; CPAMD3;
Gene ID 721
mRNA Refseq NM_001002029
Protein Refseq NP_001002029
MIM 120820
Uniprot ID P0C0L5
Chromosome Location 6p21.3
Pathway Complement Activation, Classical Pathway, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Pertussis, organism-specific biosystem; Pertussis, conserved biosystem;
Function endopeptidase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C4B Products

Required fields are marked with *

My Review for All C4B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon