Recombinant Human C3 protein(961-1040 aa), C-His-tagged

Source :	E. coli
Species :	Human
Tag :	His
Protein length :	961-1040 aa
Form :	0.15 M Phosphate buffered saline
AASequence :	DIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLE
Storage :	Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution :	It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Name	C3 complement component 3 [ Homo sapiens ]
Official Symbol	C3
Synonyms	C3; complement component 3; complement C3; CPAMD1; complement component C3; acylation-stimulating protein cleavage product; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1; ASP; AHUS5; ARMD9;
Gene ID	718
mRNA Refseq	NM_000064
Protein Refseq	NP_000055
MIM	120700
UniProt ID	P01024