Recombinant Human C2orf88 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C2orf88-4889H
• Product Overview: C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_115697) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: C2orf88 (Chromosome 2 Open Reading Frame 88) is a Protein Coding gene. Diseases associated with C2orf88 include Myostatin-Related Muscle Hypertrophy. Gene Ontology (GO) annotations related to this gene include protein kinase A regulatory subunit binding.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 10.8 kDa
• AA Sequence: MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNIVILEYAHRLSQDILCDALQQWACNNIKYHDIPYIESEGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C2orf88 chromosome 2 open reading frame 88 [ Homo sapiens (human) ]
• Official Symbol: C2orf88
• Synonyms: C2orf88; chromosome 2 open reading frame 88; small membrane A-kinase anchor protein; small A-kinase anchoring protein; small membrane AKAP
• Gene ID: 84281
• mRNA Refseq: NM_032321
• Protein Refseq: NP_115697
• MIM: 615117
• UniProt ID: Q9BSF0