Recombinant Human C2orf88 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C2orf88-837H
• Product Overview: C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035986) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Binds to type I regulatory subunits of protein kinase A (PKA-RI) and may anchor/target them to the plasma membrane.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 11 kDa
• AA Sequence: MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNIVILEYAHRLSQDILCDALQQWACNNIKYHDIPYIESEGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C2orf88 chromosome 2 open reading frame 88 [ Homo sapiens (human) ]
• Official Symbol: C2orf88
• Synonyms: C2orf88; chromosome 2 open reading frame 88; small membrane A-kinase anchor protein; small A-kinase anchoring protein; small membrane AKAP
• Gene ID: 84281
• mRNA Refseq: NM_001042521
• Protein Refseq: NP_001035986
• MIM: 615117
• UniProt ID: Q9BSF0