Recombinant Human C2orf27B Protein, GST-tagged
Cat.No. : | C2orf27B-5292H |
Product Overview : | Human MGC50273 full-length ORF ( NP_999626.1, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | C2orf27B (Chromosome 2 Open Reading Frame 27B) is a Protein Coding gene. An important paralog of this gene is C2orf27A. |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 48.5 kDa |
AA Sequence : | MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELEEAPEPSCRCPGTAQDQPSEELPDFMAPPVEPPASALELKVWLELEVAERGGQHSSSQQLPHCSQSWAQWKLWRQRPGFAIWAPLPHWRGTSLIQQSSSPAAEGPAATAAGAVCLPAGGAGEQEKEPVSRGSSRSSCSQRRPPPPGMEVCPQLGIWAICP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C2orf27B chromosome 2 open reading frame 27B [ Homo sapiens (human) ] |
Official Symbol | C2orf27B |
Synonyms | C2orf27B; chromosome 2 open reading frame 27B; uncharacterized protein LOC408029 |
Gene ID | 408029 |
mRNA Refseq | NM_214461 |
Protein Refseq | NP_999626 |
UniProt ID | Q580R0 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All C2orf27B Products
Required fields are marked with *
My Review for All C2orf27B Products
Required fields are marked with *
0
Inquiry Basket