Recombinant Human C2orf27B Protein, GST-tagged

Cat.No. : C2orf27B-5292H
Product Overview : Human MGC50273 full-length ORF ( NP_999626.1, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : C2orf27B (Chromosome 2 Open Reading Frame 27B) is a Protein Coding gene. An important paralog of this gene is C2orf27A.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 48.5 kDa
AA Sequence : MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELEEAPEPSCRCPGTAQDQPSEELPDFMAPPVEPPASALELKVWLELEVAERGGQHSSSQQLPHCSQSWAQWKLWRQRPGFAIWAPLPHWRGTSLIQQSSSPAAEGPAATAAGAVCLPAGGAGEQEKEPVSRGSSRSSCSQRRPPPPGMEVCPQLGIWAICP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C2orf27B chromosome 2 open reading frame 27B [ Homo sapiens (human) ]
Official Symbol C2orf27B
Synonyms C2orf27B; chromosome 2 open reading frame 27B; uncharacterized protein LOC408029
Gene ID 408029
mRNA Refseq NM_214461
Protein Refseq NP_999626
UniProt ID Q580R0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C2orf27B Products

Required fields are marked with *

My Review for All C2orf27B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon