Recombinant Full Length Human C2orf27B Protein, GST-tagged

• Cat.No.: C2orf27B-6428HF
• Product Overview: Human MGC50273 full-length ORF ( NP_999626.1, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C2orf27B (Chromosome 2 Open Reading Frame 27B) is a Protein Coding gene. An important paralog of this gene is C2orf27A.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 48.5 kDa
• Protein length: 209 amino acids
• AA Sequence: MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELEEAPEPSCRCPGTAQDQPSEELPDFMAPPVEPPASALELKVWLELEVAERGGQHSSSQQLPHCSQSWAQWKLWRQRPGFAIWAPLPHWRGTSLIQQSSSPAAEGPAATAAGAVCLPAGGAGEQEKEPVSRGSSRSSCSQRRPPPPGMEVCPQLGIWAICP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C2orf27B chromosome 2 open reading frame 27B [ Homo sapiens (human) ]
• Official Symbol: C2orf27B
• Synonyms: C2orf27B; chromosome 2 open reading frame 27B; uncharacterized protein LOC408029
• Gene ID: 408029
• mRNA Refseq: NM_214461
• Protein Refseq: NP_999626
• UniProt ID: Q580R0