Recombinant Human C21orf33 protein, GST-tagged

Cat.No. : C21orf33-20H
Product Overview : Recombinant Human C21orf33(1 a.a. - 268 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 268 a.a.
Description : This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 54.5 kDa
AA Sequence : MAAVRALVASRLAAASAFTSLSPGGRTPSQRAALHLSVPRPAARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name C21orf33 chromosome 21 open reading frame 33 [ Homo sapiens ]
Official Symbol C21orf33
Synonyms C21ORF33; chromosome 21 open reading frame 33; ES1 protein homolog, mitochondrial; D21S2048E; ES1; GT335; HES1; KNP I; KNP Ia; KNPH; KNPI; Keio novel protein I; human HES1 protein, homolog to E.coli and zebrafish ES1 protein;
Gene ID 8209
mRNA Refseq NM_004649
Protein Refseq NP_004640
MIM 601659
UniProt ID P30042
Chromosome Location 21q22.3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C21orf33 Products

Required fields are marked with *

My Review for All C21orf33 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon