Recombinant Human C21orf33 protein, GST-tagged

• Cat.No.: C21orf33-20H
• Product Overview: Recombinant Human C21orf33(1 a.a. - 268 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 54.5 kDa
• Protein length: 1 a.a. - 268 a.a.
• AA Sequence: MAAVRALVASRLAAASAFTSLSPGGRTPSQRAALHLSVPRPAARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: C21orf33 chromosome 21 open reading frame 33 [ Homo sapiens ]
• Official Symbol: C21orf33
• Synonyms: C21ORF33; chromosome 21 open reading frame 33; ES1 protein homolog, mitochondrial; D21S2048E; ES1; GT335; HES1; KNP I; KNP Ia; KNPH; KNPI; Keio novel protein I; human HES1 protein, homolog to E.coli and zebrafish ES1 protein
• Gene ID: 8209
• mRNA Refseq: NM_004649
• Protein Refseq: NP_004640
• MIM: 601659
• UniProt ID: P30042
• Chromosome Location: 21q22.3