Recombinant Human C21ORF33 Protein (43-268 aa), GST-tagged
| Cat.No. : | C21ORF33-1185H |
| Product Overview : | Recombinant Human C21ORF33 Protein (43-268 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | Human |
| Tag : | GST |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 50.9 kDa |
| Protein length : | 43-268 aa |
| AA Sequence : | ARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | C21orf33 chromosome 21 open reading frame 33 [ Homo sapiens ] |
| Official Symbol | C21ORF33 |
| Synonyms | C21ORF33; D21S2048E; ES1; GT335; HES1; KNP I; KNP Ia; KNPH; KNPI; |
| Gene ID | 8209 |
| mRNA Refseq | NM_004649 |
| Protein Refseq | NP_004640 |
| MIM | 601659 |
| UniProt ID | P30042 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C21ORF33 Products
Required fields are marked with *
My Review for All C21ORF33 Products
Required fields are marked with *
0
Inquiry Basket
