Recombinant Human C1QTNF3 protein, His&Myc-tagged

Cat.No. : C1QTNF3-2341H
Product Overview : Recombinant Human C1QTNF3 protein(Q9BXJ4)(23-246aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : Insect Cell
Species : Human
Tag : His&Myc
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 28.1 kDa
Protein length : 23-246aa
AA Sequence : QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name C1QTNF3 C1q and tumor necrosis factor related protein 3 [ Homo sapiens ]
Official Symbol C1QTNF3
Synonyms C1QTNF3; C1q and tumor necrosis factor related protein 3; complement C1q tumor necrosis factor-related protein 3; 2310005P21Rik; cartonectin; Corcs; Cors; Cors 26; CTRP3; secretory protein CORS26; collagenous repeat-containing sequence of 26-kDa; CORS; CORCS; CORS26; C1ATNF3; CORS-26; FLJ37576;
Gene ID 114899
mRNA Refseq NM_030945
Protein Refseq NP_112207
MIM 612045
UniProt ID Q9BXJ4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C1QTNF3 Products

Required fields are marked with *

My Review for All C1QTNF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon