Recombinant Human C1QTNF3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | C1QTNF3-3322H |
Product Overview : | C1QTNF3 MS Standard C13 and N15-labeled recombinant protein (NP_852100) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | C1QTNF3 (C1q And TNF Related 3) is a Protein Coding gene. Diseases associated with C1QTNF3 include Pyosalpinx and Bleeding Disorder, Platelet-Type, 14. An important paralog of this gene is C1QTNF3-AMACR. |
Molecular Mass : | 35 kDa |
AA Sequence : | MLWRQLIYWQLLALFFLPFCLCQDEYMEVSGRTNKVVARIVQSHQQTGRSGSRREKVRERSHPKTGTVDNNTSTDLKSLRPDELPHPEVDDLAQITTFWGQSPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C1QTNF3 C1q and tumor necrosis factor related protein 3 [ Homo sapiens (human) ] |
Official Symbol | C1QTNF3 |
Synonyms | C1QTNF3; C1q and tumor necrosis factor related protein 3; complement C1q tumor necrosis factor-related protein 3; 2310005P21Rik; cartonectin; Corcs; Cors; Cors 26; CTRP3; secretory protein CORS26; collagenous repeat-containing sequence of 26-kDa; CORS; CORCS; CORS26; C1ATNF3; CORS-26; FLJ37576; |
Gene ID | 114899 |
mRNA Refseq | NM_181435 |
Protein Refseq | NP_852100 |
MIM | 612045 |
UniProt ID | Q9BXJ4 |
◆ Recombinant Proteins | ||
C1QTNF3-467H | Recombinant Human C1QTNF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
C1QTNF3-2504M | Recombinant Mouse C1QTNF3 Protein (23-246 aa), His-Myc-tagged | +Inquiry |
C1QTNF3-2761M | Recombinant Mouse C1QTNF3 Protein (23-246 aa), His-tagged | +Inquiry |
C1QTNF3-2801Z | Recombinant Zebrafish C1QTNF3 | +Inquiry |
C1QTNF3-3218M | Recombinant Mouse C1QTNF3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QTNF3-8137HCL | Recombinant Human C1QTNF3 293 Cell Lysate | +Inquiry |
C1QTNF3-8136HCL | Recombinant Human C1QTNF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C1QTNF3 Products
Required fields are marked with *
My Review for All C1QTNF3 Products
Required fields are marked with *
0
Inquiry Basket