Recombinant Human C1orf54 Protein, GST-tagged

• Cat.No.: C1orf54-4283H
• Product Overview: Human FLJ23221 full-length ORF ( AAH17761, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C1orf54 (Chromosome 1 Open Reading Frame 54) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 40.15 kDa
• AA Sequence: MDVLFVAIFAVPLILGQEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C1orf54 chromosome 1 open reading frame 54 [ Homo sapiens ]
• Official Symbol: C1orf54
• Synonyms: C1ORF54; chromosome 1 open reading frame 54; uncharacterized protein C1orf54; FLJ23221
• Gene ID: 79630
• mRNA Refseq: NM_024579
• Protein Refseq: NP_078855
• UniProt ID: Q8WWF1