Recombinant Human C1ORF54 Protein (17-131 aa), His-B2M-tagged

Cat.No. : C1ORF54-2187H
Product Overview : Recombinant Human C1ORF54 Protein (17-131 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : B2M&His
Protein Length : 17-131 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 27.2 kDa
AA Sequence : QEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name C1orf54 chromosome 1 open reading frame 54 [ Homo sapiens ]
Official Symbol C1ORF54
Synonyms C1ORF54; chromosome 1 open reading frame 54; uncharacterized protein C1orf54; FLJ23221;
Gene ID 79630
mRNA Refseq NM_024579
Protein Refseq NP_078855
UniProt ID Q8WWF1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C1ORF54 Products

Required fields are marked with *

My Review for All C1ORF54 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon