Recombinant Human C12orf42 Protein, GST-tagged

Cat.No. : C12orf42-503H
Product Overview : Human C12orf42 full-length ORF ( AAH44617.1, 1 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 55 kDa
AA Sequence : MACKRLLHTCQYIVPRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPKQAWNSSFLEQLVKKPNWAHSVNPVHLEAQGIHISRHTRPKGQPLSSPKKNSGSAARPSTAIGLCRRSQTPGALQSTGPSNTELEPEERMAVPAGAQAHPDDIQSRLLGASGNPVGKGAVAMAPEMLPKHPHTPRDRRPQADTSLHGNLAGAPLPLLAGASTHFPSKRLIKVCSSAPPRPTRRFHTVCSQALSRPVVNAHLH
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C12orf42 chromosome 12 open reading frame 42 [ Homo sapiens ]
Official Symbol C12orf42
Synonyms C12ORF42; chromosome 12 open reading frame 42; uncharacterized protein C12orf42; FLJ25323; MGC43592; MGC57409;
Gene ID 374470
mRNA Refseq NM_001099336
Protein Refseq NP_001092806
UniProt ID Q96LP6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C12orf42 Products

Required fields are marked with *

My Review for All C12orf42 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon