Recombinant Full Length Human C12orf42 Protein, GST-tagged

• Cat.No.: C12orf42-1750HF
• Product Overview: Human C12orf42 full-length ORF ( AAH44617.1, 1 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 265 amino acids
• Description: C12orf42 (Chromosome 12 Open Reading Frame 42) is a Protein Coding gene. Diseases associated with C12orf42 include Dyschromatosis Universalis Hereditaria.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 55 kDa
• AA Sequence: MACKRLLHTCQYIVPRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPKQAWNSSFLEQLVKKPNWAHSVNPVHLEAQGIHISRHTRPKGQPLSSPKKNSGSAARPSTAIGLCRRSQTPGALQSTGPSNTELEPEERMAVPAGAQAHPDDIQSRLLGASGNPVGKGAVAMAPEMLPKHPHTPRDRRPQADTSLHGNLAGAPLPLLAGASTHFPSKRLIKVCSSAPPRPTRRFHTVCSQALSRPVVNAHLH
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C12orf42 chromosome 12 open reading frame 42 [ Homo sapiens ]
• Official Symbol: C12orf42
• Synonyms: C12ORF42; chromosome 12 open reading frame 42; uncharacterized protein C12orf42; FLJ25323; MGC43592; MGC57409
• Gene ID: 374470
• mRNA Refseq: NM_001099336
• Protein Refseq: NP_001092806
• UniProt ID: Q96LP6