Recombinant Human C11orf87 Protein, GST-tagged
Cat.No. : | C11orf87-491H |
Product Overview : | Human C11orf87 full-length ORF ( NP_997528.1, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 47 kDa |
AA Sequence : | MSARAPKELRLALPPCLLNRTFASPNASGSGNTGARGPGAVGSGTCITQVGQQLFQSFSSTLVLIVLVTVIFCLIVLSLSTFHIHKRRMKKRKMQRAQEEYERDHCSGSRGGGGLPRPGRQAPTHAKETRLERQPRDSPFCAPSNASSLSSSSPGLPCQGPCAPPPPPPASSPQGAHAASSCLDTAGEGLLQTVVLS |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C11orf87 chromosome 11 open reading frame 87 [ Homo sapiens ] |
Official Symbol | C11orf87 |
Synonyms | C11ORF87; chromosome 11 open reading frame 87; uncharacterized protein C11orf87; LOC399947; LOH11CR1A; FLJ33767; |
Gene ID | 399947 |
mRNA Refseq | NM_207645 |
Protein Refseq | NP_997528 |
UniProt ID | Q6NUJ2 |
◆ Recombinant Proteins | ||
C11orf87-2018HF | Recombinant Full Length Human C11orf87 Protein, GST-tagged | +Inquiry |
C11orf87-1282H | Recombinant Human C11orf87 Protein, MYC/DDK-tagged | +Inquiry |
C11orf87-1617H | Recombinant Human C11orf87 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C11orf87-491H | Recombinant Human C11orf87 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C11orf87 Products
Required fields are marked with *
My Review for All C11orf87 Products
Required fields are marked with *
0
Inquiry Basket