Recombinant Full Length Human C11orf87 Protein, GST-tagged

• Cat.No.: C11orf87-2018HF
• Product Overview: Human C11orf87 full-length ORF ( NP_997528.1, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 197 amino acids
• Description: Predicted to be integral component of membrane.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 47 kDa
• AA Sequence: MSARAPKELRLALPPCLLNRTFASPNASGSGNTGARGPGAVGSGTCITQVGQQLFQSFSSTLVLIVLVTVIFCLIVLSLSTFHIHKRRMKKRKMQRAQEEYERDHCSGSRGGGGLPRPGRQAPTHAKETRLERQPRDSPFCAPSNASSLSSSSPGLPCQGPCAPPPPPPASSPQGAHAASSCLDTAGEGLLQTVVLS
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C11orf87 chromosome 11 open reading frame 87 [ Homo sapiens ]
• Official Symbol: C11orf87
• Synonyms: C11ORF87; chromosome 11 open reading frame 87; uncharacterized protein C11orf87; LOC399947; LOH11CR1A; FLJ33767
• Gene ID: 399947
• mRNA Refseq: NM_207645
• Protein Refseq: NP_997528
• UniProt ID: Q6NUJ2