Recombinant Human C11orf73 protein, His-SUMO-tagged

• Cat.No.: C11orf73-4501H
• Product Overview: Recombinant Human C11orf73 protein(Q53FT3)(1-197aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 37.6 kDa
• Protein length: 1-197aa
• AA Sequence: MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: C11orf73 chromosome 11 open reading frame 73 [ Homo sapiens ]
• Official Symbol: C11orf73
• Synonyms: C11ORF73; chromosome 11 open reading frame 73; uncharacterized protein C11orf73; HSPC138; HSPC179; lethal, Chr 7, Rinchik 6; L7RN6; FLJ43020
• Gene ID: 51501
• mRNA Refseq: NM_016401
• Protein Refseq: NP_057485
• UniProt ID: Q53FT3