Recombinant Human C11orf73 protein, His-SUMO-tagged
Cat.No. : | C11orf73-4501H |
Product Overview : | Recombinant Human C11orf73 protein(Q53FT3)(1-197aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-197aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.6 kDa |
AA Sequence : | MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | C11orf73 chromosome 11 open reading frame 73 [ Homo sapiens ] |
Official Symbol | C11orf73 |
Synonyms | C11ORF73; chromosome 11 open reading frame 73; uncharacterized protein C11orf73; HSPC138; HSPC179; lethal, Chr 7, Rinchik 6; L7RN6; FLJ43020; |
Gene ID | 51501 |
mRNA Refseq | NM_016401 |
Protein Refseq | NP_057485 |
UniProt ID | Q53FT3 |
◆ Recombinant Proteins | ||
C11orf73-484H | Recombinant Human C11orf73 Protein, GST-tagged | +Inquiry |
C11orf73-10365H | Recombinant Human C11orf73, His-tagged | +Inquiry |
C11orf73-4501H | Recombinant Human C11orf73 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C11orf73-8336HCL | Recombinant Human C11orf73 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C11orf73 Products
Required fields are marked with *
My Review for All C11orf73 Products
Required fields are marked with *
0
Inquiry Basket