Recombinant Human C11orf73 Protein, GST-tagged

• Cat.No.: C11orf73-484H
• Product Overview: Human C11orf73 full-length ORF ( NP_057485.2, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 48 kDa
• AA Sequence: MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C11orf73 chromosome 11 open reading frame 73 [ Homo sapiens ]
• Official Symbol: C11orf73
• Synonyms: C11ORF73; chromosome 11 open reading frame 73; uncharacterized protein C11orf73; HSPC138; HSPC179; lethal, Chr 7, Rinchik 6; L7RN6; FLJ43020
• Gene ID: 51501
• mRNA Refseq: NM_016401
• Protein Refseq: NP_057485
• UniProt ID: Q53FT3