Recombinant Human C10orf82 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C10orf82-1568H
• Product Overview: C10orf82 MS Standard C13 and N15-labeled recombinant protein (NP_653262) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: C10orf82 (Chromosome 10 Open Reading Frame 82) is a Protein Coding gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 17.8 kDa
• AA Sequence: MEPSKTFMRNLPITPGYSGFVPFLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVNSEETVLQALHQYNLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEITERAKKAHLKPYEETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C10orf82 chromosome 10 open reading frame 82 [ Homo sapiens (human) ]
• Official Symbol: C10orf82
• Synonyms: C10ORF82; chromosome 10 open reading frame 82; uncharacterized protein C10orf82; Em:AC016825.4; MGC33547; FLJ40268
• Gene ID: 143379
• mRNA Refseq: NM_144661
• Protein Refseq: NP_653262
• UniProt ID: Q8WW14