Recombinant Human C10orf82 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C10orf82-1568H
Product Overview : C10orf82 MS Standard C13 and N15-labeled recombinant protein (NP_653262) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : C10orf82 (Chromosome 10 Open Reading Frame 82) is a Protein Coding gene.
Molecular Mass : 17.8 kDa
AA Sequence : MEPSKTFMRNLPITPGYSGFVPFLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVNSEETVLQALHQYNLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEITERAKKAHLKPYEETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C10orf82 chromosome 10 open reading frame 82 [ Homo sapiens (human) ]
Official Symbol C10orf82
Synonyms C10ORF82; chromosome 10 open reading frame 82; uncharacterized protein C10orf82; Em:AC016825.4; MGC33547; FLJ40268;
Gene ID 143379
mRNA Refseq NM_144661
Protein Refseq NP_653262
UniProt ID Q8WW14

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C10orf82 Products

Required fields are marked with *

My Review for All C10orf82 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon