Recombinant Human C10orf82 Protein, GST-tagged

Cat.No. : C10orf82-447H
Product Overview : Human C10orf82 full-length ORF ( NP_653262.1, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 44.2 kDa
AA Sequence : MEPSKTFMRNLPITPGYSGFVPFLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVNSEETVLQALHQYNLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEITERAKKAHLKPYEE
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C10orf82 chromosome 10 open reading frame 82 [ Homo sapiens ]
Official Symbol C10orf82
Synonyms C10ORF82; chromosome 10 open reading frame 82; uncharacterized protein C10orf82; Em:AC016825.4; MGC33547; FLJ40268;
Gene ID 143379
mRNA Refseq NM_144661
Protein Refseq NP_653262
UniProt ID Q8WW14

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C10orf82 Products

Required fields are marked with *

My Review for All C10orf82 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon