Recombinant Human C10orf82 Protein, GST-tagged

• Cat.No.: C10orf82-447H
• Product Overview: Human C10orf82 full-length ORF ( NP_653262.1, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 44.2 kDa
• AA Sequence: MEPSKTFMRNLPITPGYSGFVPFLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVNSEETVLQALHQYNLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEITERAKKAHLKPYEE
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C10orf82 chromosome 10 open reading frame 82 [ Homo sapiens ]
• Official Symbol: C10orf82
• Synonyms: C10ORF82; chromosome 10 open reading frame 82; uncharacterized protein C10orf82; Em:AC016825.4; MGC33547; FLJ40268
• Gene ID: 143379
• mRNA Refseq: NM_144661
• Protein Refseq: NP_653262
• UniProt ID: Q8WW14