Recombinant Human BTLA protein, mFc-Avi-tagged, Biotinylated

• Cat.No.: BTLA-7453H
• Product Overview: Recombinant Human BTLA protein(Q7Z6A9)(31-150aa), fused with C-terminal mFc and Avi tag, was expressed in HEK293.

Specification

• Source: HEK293
• Species: Human
• Tag: C-mFc-Avi
• Protein length: 31-150aa
• Conjugation/Label: Biotin
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42.7 kDa
• AASequence: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
• Purity: Greater than 90% as determined by SDS-PAGE.
  Greater than 90% as determined by SEC-HPLC.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: BTLA B and T lymphocyte associated [ Homo sapiens ]
• Official Symbol: BTLA
• Synonyms: BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; BTLA1; CD272; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; FLJ16065; MGC129743
• Gene ID: 151888
• mRNA Refseq: NM_001085357
• Protein Refseq: NP_001078826
• MIM: 607925
• UniProt ID: Q7Z6A9