Recombinant Mouse Btla Protein, hIgG/His-tagged

• Cat.No.: Btla-03M
• Product Overview: Recombinant mouse BTLA, fused to hIgG-His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: HEK293
• Tag: Fc&His
• Description: Biased expression in spleen adult (RPKM 9.3), mammary gland adult (RPKM 3.5) and 3 other tissues.
• Form: Liquid
• Molecular Mass: 44.1 kDa
• AA Sequence: EKATKRNDEECEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLIISDIPDATNASGPSTMEKRPG
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL
• Storage Buffer: In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: Btla B and T lymphocyte associated [ Mus musculus (house mouse) ]
• Official Symbol: Btla
• Synonyms: Btla; B and T lymphocyte associated; A630002H24; B- and T-lymphocyte attenuator; B- and T-lymphocyte-associated protein
• Gene ID: 208154
• mRNA Refseq: NM_177584
• Protein Refseq: NP_808252
• UniProt ID: Q32MV9