Recombinant Human BPIFA2 protein

• Cat.No.: BPIFA2-2450H
• Product Overview: Recombinant Human BPIFA2 protein(Q96DR5)(19-249aa), fused to Tag-Free, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 19-249aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 25.1 kDa
• AA Sequence: ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: BPIFA2 BPI fold containing family A, member 2 [ Homo sapiens ]
• Official Symbol: BPIFA2
• Synonyms: BPIFA2; BPI fold containing family A, member 2; C20orf70, chromosome 20 open reading frame 70; BPI fold-containing family A member 2; bA49G10.1; PSP; SPLUNC2; parotid secretory protein; short palate, lung and nasal epithelium carcinoma associated 2; short palate, lung and nasal epithelium carcinoma-associated protein 2; C20orf70
• Gene ID: 140683
• mRNA Refseq: NM_080574
• Protein Refseq: NP_542141
• UniProt ID: Q96DR5