Recombinant Human BPIFA2 Protein (14-249 aa)

Cat.No. : BPIFA2-2264H
Product Overview : Recombinant Human BPIFA2 Protein (14-249 aa) is produced by Yeast expression system. Research Area: Developmental Biology. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : Non
Protein Length : 14-249 aa
Description : Has strong antibacterial activity against P. aeruginosa.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 25.1 kDa
AA Sequence : ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name BPIFA2 BPI fold containing family A, member 2 [ Homo sapiens ]
Official Symbol BPIFA2
Synonyms BPIFA2; bA49G10.1; PSP; SPLUNC2; parotid secretory protein; C20orf70;
Gene ID 140683
mRNA Refseq NM_080574
Protein Refseq NP_542141
UniProt ID Q96DR5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BPIFA2 Products

Required fields are marked with *

My Review for All BPIFA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon